PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN04298.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 328aa    MW: 36594 Da    PI: 5.6988
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN04298.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.41.4e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd+ll ++++ +G+g+W+t ++  g+ R++k+c++rw +yl
       KHN04298.1 14 KGPWTPEEDLLLTNYIQTYGPGNWRTLPKNAGLQRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding51.72e-1667110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+++ eE+e +++++  lG++ W++Ia++++ gRt++++k++w++
       KHN04298.1  67 RGKFSFEEEEAIIQLHSVLGNK-WSAIAAKLP-GRTDNEIKNYWNT 110
                      89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.6E-26564IPR009057Homeodomain-like
PROSITE profilePS5129417.911961IPR017930Myb domain
SuperFamilySSF466894.49E-3111108IPR009057Homeodomain-like
SMARTSM007177.8E-141363IPR001005SANT/Myb domain
PfamPF002491.1E-151461IPR001005SANT/Myb domain
CDDcd001678.81E-121661No hitNo description
PROSITE profilePS5129424.71162116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.1E-2565116IPR009057Homeodomain-like
SMARTSM007176.7E-1666114IPR001005SANT/Myb domain
PfamPF002496.2E-1567110IPR001005SANT/Myb domain
CDDcd001673.91E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MGRAPCCDKN DLKKGPWTPE EDLLLTNYIQ TYGPGNWRTL PKNAGLQRCG KSCRLRWTNY  60
LRPDIKRGKF SFEEEEAIIQ LHSVLGNKWS AIAAKLPGRT DNEIKNYWNT NIRKRLLRMG  120
IDPVTHAPRL DLLDMSSILR SAIGTVNPSF LNLQGLLGAQ ALMNPEFFKL AATATLLSLK  180
NHENASNLVS QVQQQFNNNA GNGQVQNQVA APNQFQTPTL SNNNVNNGLS SISPENSSIP  240
SYLGENNYQL NAQQINQVDL LLDPELEHYL NSINQNIGHE SVTPLSTPTS LNSSSTYVNS  300
CAEEERDTYC SDVFKLEIPE SLDISDFL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A2e-30111161105MYB PROTO-ONCOGENE PROTEIN
1mse_C2e-30121162105C-Myb DNA-Binding Domain
1msf_C2e-30121162105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003540334.10.0PREDICTED: myb-related protein 330-like
TrEMBLA0A0B2P9F90.0A0A0B2P9F9_GLYSO; Transcription factor MYB39
TrEMBLI1LUB50.0I1LUB5_SOYBN; Uncharacterized protein
STRINGGLYMA12G32610.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF85034127
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21440.12e-88MYB-like 102
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]